Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial

Artikelnummer: BYT-ORB3009164
Artikelname: Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial
Artikelnummer: BYT-ORB3009164
Hersteller Artikelnummer: orb3009164
Alternativnummer: BYT-ORB3009164-1, BYT-ORB3009164-100, BYT-ORB3009164-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Putative transmembrane protein INAFM2, InaF-motif-containing protein 2, Osteogenesis up-regulated transcript 1, INAFM2 LINC00984 OGU1
This Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial spans the amino acid sequence from region 57-153. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DMQ5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: YSLIWQPVGAGTSGGAAGPPPGGSNATGPSGTSGAAAAGPNTTGSSRREAPRDVPPLQAARPAPPEPPADSPPAGPLERPRGPDEDEEETAAAPGSR
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)