Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial

Catalog Number: BYT-ORB3009164
Article Name: Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial
Biozol Catalog Number: BYT-ORB3009164
Supplier Catalog Number: orb3009164
Alternative Catalog Number: BYT-ORB3009164-1, BYT-ORB3009164-100, BYT-ORB3009164-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Putative transmembrane protein INAFM2, InaF-motif-containing protein 2, Osteogenesis up-regulated transcript 1, INAFM2 LINC00984 OGU1
This Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial spans the amino acid sequence from region 57-153. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DMQ5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YSLIWQPVGAGTSGGAAGPPPGGSNATGPSGTSGAAAAGPNTTGSSRREAPRDVPPLQAARPAPPEPPADSPPAGPLERPRGPDEDEEETAAAPGSR
Application Notes: Biological Origin: Homo sapiens (Human)