Recombinant Human Uncharacterized protein C8orf88 (CH088)

Artikelnummer: BYT-ORB3009166
Artikelname: Recombinant Human Uncharacterized protein C8orf88 (CH088)
Artikelnummer: BYT-ORB3009166
Hersteller Artikelnummer: orb3009166
Alternativnummer: BYT-ORB3009166-1, BYT-ORB3009166-100, BYT-ORB3009166-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Uncharacterized protein C8orf88 C8orf88
This Recombinant Human Uncharacterized protein C8orf88 (CH088) spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DMB2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCKTNGMQAFSQGLNEQQQQQSPVKKERIKYSRDFLLKLSSVSICRKKPDFLPDHPIVLQKPENNQSFK
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)