Recombinant Human Uncharacterized protein C8orf88 (CH088)

Product Overview

• Article Name: Recombinant Human Uncharacterized protein C8orf88 (CH088)
• Biozol Catalog Number: BYT-ORB3009166
• Supplier Catalog Number: orb3009166
• Alternative Catalog Number: BYT-ORB3009166-1, BYT-ORB3009166-100, BYT-ORB3009166-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Uncharacterized protein C8orf88 C8orf88

Product Description

This Recombinant Human Uncharacterized protein C8orf88 (CH088) spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: P0DMB2
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCKTNGMQAFSQGLNEQQQQQSPVKKERIKYSRDFLLKLSSVSICRKKPDFLPDHPIVLQKPENNQSFK

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)