Recombinant Human Protein RD3-like (RD3L)

Artikelnummer: BYT-ORB3009173
Artikelname: Recombinant Human Protein RD3-like (RD3L)
Artikelnummer: BYT-ORB3009173
Hersteller Artikelnummer: orb3009173
Alternativnummer: BYT-ORB3009173-1, BYT-ORB3009173-100, BYT-ORB3009173-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Protein RD3-like, Retinal degeneration protein 3-like, RD3L
This Recombinant Human Protein RD3-like (RD3L) spans the amino acid sequence from region 1-198. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DJH9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MPLFGWMKWPKNDSYKPTHYPGSDIVTKTLLRELKWHLKERERLIQEIENEQKVKKTGVDYNWLRNYQNPHTTIPVTEQRQLEVLCSQVQPCQTGTILSRFREVLAENDVLPWEIVYIFKQVLKDFLSSSDRGSEQEDLEDSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDRFPVFSHRIWNLPYYHPSS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)