Recombinant Human Protein RD3-like (RD3L)

Catalog Number: BYT-ORB3009173
Article Name: Recombinant Human Protein RD3-like (RD3L)
Biozol Catalog Number: BYT-ORB3009173
Supplier Catalog Number: orb3009173
Alternative Catalog Number: BYT-ORB3009173-1, BYT-ORB3009173-100, BYT-ORB3009173-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein RD3-like, Retinal degeneration protein 3-like, RD3L
This Recombinant Human Protein RD3-like (RD3L) spans the amino acid sequence from region 1-198. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: P0DJH9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPLFGWMKWPKNDSYKPTHYPGSDIVTKTLLRELKWHLKERERLIQEIENEQKVKKTGVDYNWLRNYQNPHTTIPVTEQRQLEVLCSQVQPCQTGTILSRFREVLAENDVLPWEIVYIFKQVLKDFLSSSDRGSEQEDLEDSGSMDCSAPSVIQGDSSKRADKDEIPTISSYVDKNTKDRFPVFSHRIWNLPYYHPSS
Application Notes: Biological Origin: Homo sapiens (Human)