Recombinant Human RING finger protein 225 (RN225), partial

Produktübersicht

• Artikelname: Recombinant Human RING finger protein 225 (RN225), partial
• Artikelnummer: BYT-ORB3009174
• Hersteller Artikelnummer: orb3009174
• Alternativnummer: BYT-ORB3009174-1, BYT-ORB3009174-100, BYT-ORB3009174-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: RING finger protein 225 RNF225

Produktbeschreibung

This Recombinant Human RING finger protein 225 (RN225), partial spans the amino acid sequence from region 1-202. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: M0QZC1
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MPCPRPFWLRHSRAPQGSGPSSPGSLSAPRSPSRGEDQEEEEEEEGDGSPGSGPILPPASPVECLICVSSFDGVFKLPKRLDCGHVFCLECLARLSLATAGGGNAVACPVCRAPTRLAPRRGLPALPTQSGLLPRDARAPPSRQGSVRFDRRRGLLYLRPPPPPPGPRKARAPPPPPPLRLGRPLSRRLSLASPAWVFNAAV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)