Recombinant Human RING finger protein 225 (RN225), partial

Product Overview

• Article Name: Recombinant Human RING finger protein 225 (RN225), partial
• Biozol Catalog Number: BYT-ORB3009174
• Supplier Catalog Number: orb3009174
• Alternative Catalog Number: BYT-ORB3009174-1, BYT-ORB3009174-100, BYT-ORB3009174-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: RING finger protein 225 RNF225

Product Description

This Recombinant Human RING finger protein 225 (RN225), partial spans the amino acid sequence from region 1-202. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: M0QZC1
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MPCPRPFWLRHSRAPQGSGPSSPGSLSAPRSPSRGEDQEEEEEEEGDGSPGSGPILPPASPVECLICVSSFDGVFKLPKRLDCGHVFCLECLARLSLATAGGGNAVACPVCRAPTRLAPRRGLPALPTQSGLLPRDARAPPSRQGSVRFDRRRGLLYLRPPPPPPGPRKARAPPPPPPLRLGRPLSRRLSLASPAWVFNAAV

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)