Recombinant Human piRNA-mediated silencing protein C19orf84 (CS084)

Artikelnummer: BYT-ORB3009177
Artikelname: Recombinant Human piRNA-mediated silencing protein C19orf84 (CS084)
Artikelnummer: BYT-ORB3009177
Hersteller Artikelnummer: orb3009177
Alternativnummer: BYT-ORB3009177-1, BYT-ORB3009177-100, BYT-ORB3009177-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: piRNA-mediated silencing protein C19orf84 C19orf84
This Recombinant Human piRNA-mediated silencing protein C19orf84 (CS084) spans the amino acid sequence from region 1-186. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: I3L1E1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEQPKDGAGPEGNNLSLPSSGTEPWPPAPLPAPPPLLLNSTDPTHLGLPESVASVTVPIRLDTLSCLLHSALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWEVRHRPGWGRGLHRRGLGRAEQPERGRAGGPGAGPRTPPMTLPSPPTLPAQDGKKEARGPEPPLETPLAAEDWETEY
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)