Recombinant Human piRNA-mediated silencing protein C19orf84 (CS084)

Catalog Number: BYT-ORB3009177
Article Name: Recombinant Human piRNA-mediated silencing protein C19orf84 (CS084)
Biozol Catalog Number: BYT-ORB3009177
Supplier Catalog Number: orb3009177
Alternative Catalog Number: BYT-ORB3009177-1, BYT-ORB3009177-100, BYT-ORB3009177-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: piRNA-mediated silencing protein C19orf84 C19orf84
This Recombinant Human piRNA-mediated silencing protein C19orf84 (CS084) spans the amino acid sequence from region 1-186. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: I3L1E1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEQPKDGAGPEGNNLSLPSSGTEPWPPAPLPAPPPLLLNSTDPTHLGLPESVASVTVPIRLDTLSCLLHSALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWEVRHRPGWGRGLHRRGLGRAEQPERGRAGGPGAGPRTPPMTLPSPPTLPAQDGKKEARGPEPPLETPLAAEDWETEY
Application Notes: Biological Origin: Homo sapiens (Human)