Recombinant Human Putative uncharacterized protein PYCARD-AS1 (PYAS1)

Artikelnummer: BYT-ORB3009178
Artikelname: Recombinant Human Putative uncharacterized protein PYCARD-AS1 (PYAS1)
Artikelnummer: BYT-ORB3009178
Hersteller Artikelnummer: orb3009178
Alternativnummer: BYT-ORB3009178-1, BYT-ORB3009178-100, BYT-ORB3009178-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Putative uncharacterized protein PYCARD-AS1, PYCARD antisense RNA 1, PYCARD antisense gene protein 1, PYCARD opposite strand protein, PYCARD-AS1 C16orf98 PYCARDOS
This Recombinant Human Putative uncharacterized protein PYCARD-AS1 (PYAS1) spans the amino acid sequence from region 1-204. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: I3L0S3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MRAHVAQHVSGELGAVGLQVEADQLVGEVQGVHGQQRAPRDAPVALAQRHRQQLQLELLELLGGQVLQRIQDGVARAPHGSRIPGRCRRSPRCSRRPGGSRLRGGTWTPRLPPTLVSRLPAPVRCPPAKGASLLHPWSPPTQASGLGPQAVGGRQDRALQLACEVGPGRGPQRGSWVAPACLWACTSGYRPETWAGSHWVYWST
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)