Recombinant Human Putative uncharacterized protein PYCARD-AS1 (PYAS1)

Catalog Number: BYT-ORB3009178
Article Name: Recombinant Human Putative uncharacterized protein PYCARD-AS1 (PYAS1)
Biozol Catalog Number: BYT-ORB3009178
Supplier Catalog Number: orb3009178
Alternative Catalog Number: BYT-ORB3009178-1, BYT-ORB3009178-100, BYT-ORB3009178-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Putative uncharacterized protein PYCARD-AS1, PYCARD antisense RNA 1, PYCARD antisense gene protein 1, PYCARD opposite strand protein, PYCARD-AS1 C16orf98 PYCARDOS
This Recombinant Human Putative uncharacterized protein PYCARD-AS1 (PYAS1) spans the amino acid sequence from region 1-204. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: I3L0S3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MRAHVAQHVSGELGAVGLQVEADQLVGEVQGVHGQQRAPRDAPVALAQRHRQQLQLELLELLGGQVLQRIQDGVARAPHGSRIPGRCRRSPRCSRRPGGSRLRGGTWTPRLPPTLVSRLPAPVRCPPAKGASLLHPWSPPTQASGLGPQAVGGRQDRALQLACEVGPGRGPQRGSWVAPACLWACTSGYRPETWAGSHWVYWST
Application Notes: Biological Origin: Homo sapiens (Human)