Recombinant Human Claudin-34 (CLD34), partial

Artikelnummer: BYT-ORB3009180
Artikelname: Recombinant Human Claudin-34 (CLD34), partial
Artikelnummer: BYT-ORB3009180
Hersteller Artikelnummer: orb3009180
Alternativnummer: BYT-ORB3009180-1, BYT-ORB3009180-100, BYT-ORB3009180-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Claudin-34 CLDN34
This Recombinant Human Claudin-34 (CLD34), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H7C241
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)