Recombinant Human Claudin-34 (CLD34), partial

Catalog Number: BYT-ORB3009180
Article Name: Recombinant Human Claudin-34 (CLD34), partial
Biozol Catalog Number: BYT-ORB3009180
Supplier Catalog Number: orb3009180
Alternative Catalog Number: BYT-ORB3009180-1, BYT-ORB3009180-100, BYT-ORB3009180-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Claudin-34 CLDN34
This Recombinant Human Claudin-34 (CLD34), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H7C241
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT
Application Notes: Biological Origin: Homo sapiens (Human)