Recombinant Human POTE ankyrin domain family member B2 (POTB2)

Artikelnummer: BYT-ORB3009183
Artikelname: Recombinant Human POTE ankyrin domain family member B2 (POTB2)
Artikelnummer: BYT-ORB3009183
Hersteller Artikelnummer: orb3009183
Alternativnummer: BYT-ORB3009183-1, BYT-ORB3009183-100, BYT-ORB3009183-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: POTE ankyrin domain family member B2 POTEB2
This Recombinant Human POTE ankyrin domain family member B2 (POTB2) spans the amino acid sequence from region 1-544. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H3BUK9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVAEVCSMPAASAVKKPFDLRSKMGKWCHHRFPCCRGSGTSNVGTSGDHDDSFMKTLRSKMGKWCCHCFPCCRGSGKSNVGTWGDYDDSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLRDTDMNKRDKQKRTALHLASANGNSEVVQLLLDRRCQLNVLDNKKRTALIKAVQCQEDECVLMLLEHGADGNIQDEYGNTALHYAIYNEDKLMAKALLLYGADIESKNKCGLTPLLLGVHEQKQEVVKFLI
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)