Recombinant Human POTE ankyrin domain family member B2 (POTB2)

Catalog Number: BYT-ORB3009183
Article Name: Recombinant Human POTE ankyrin domain family member B2 (POTB2)
Biozol Catalog Number: BYT-ORB3009183
Supplier Catalog Number: orb3009183
Alternative Catalog Number: BYT-ORB3009183-1, BYT-ORB3009183-100, BYT-ORB3009183-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: POTE ankyrin domain family member B2 POTEB2
This Recombinant Human POTE ankyrin domain family member B2 (POTB2) spans the amino acid sequence from region 1-544. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H3BUK9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MVAEVCSMPAASAVKKPFDLRSKMGKWCHHRFPCCRGSGTSNVGTSGDHDDSFMKTLRSKMGKWCCHCFPCCRGSGKSNVGTWGDYDDSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLRDTDMNKRDKQKRTALHLASANGNSEVVQLLLDRRCQLNVLDNKKRTALIKAVQCQEDECVLMLLEHGADGNIQDEYGNTALHYAIYNEDKLMAKALLLYGADIESKNKCGLTPLLLGVHEQKQEVVKFLI
Application Notes: Biological Origin: Homo sapiens (Human)