Recombinant Human Testis-expressed protein 46 (TEX46), partial

Artikelnummer: BYT-ORB3009185
Artikelname: Recombinant Human Testis-expressed protein 46 (TEX46), partial
Artikelnummer: BYT-ORB3009185
Hersteller Artikelnummer: orb3009185
Alternativnummer: BYT-ORB3009185-1, BYT-ORB3009185-100, BYT-ORB3009185-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Testis-expressed protein 46 TEX46 C1orf234
This Recombinant Human Testis-expressed protein 46 (TEX46), partial spans the amino acid sequence from region 37-121. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H3BTG2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LSNWLVKYEHKLTLPEPQQDEILQRLLFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSPS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)