Recombinant Human Testis-expressed protein 46 (TEX46), partial

Catalog Number: BYT-ORB3009185
Article Name: Recombinant Human Testis-expressed protein 46 (TEX46), partial
Biozol Catalog Number: BYT-ORB3009185
Supplier Catalog Number: orb3009185
Alternative Catalog Number: BYT-ORB3009185-1, BYT-ORB3009185-100, BYT-ORB3009185-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Testis-expressed protein 46 TEX46 C1orf234
This Recombinant Human Testis-expressed protein 46 (TEX46), partial spans the amino acid sequence from region 37-121. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H3BTG2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LSNWLVKYEHKLTLPEPQQDEILQRLLFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSPS
Application Notes: Biological Origin: Homo sapiens (Human)