Recombinant Human MKRN2 opposite strand protein (MKROS)

Produktübersicht

• Artikelname: Recombinant Human MKRN2 opposite strand protein (MKROS)
• Artikelnummer: BYT-ORB3009190
• Hersteller Artikelnummer: orb3009190
• Alternativnummer: BYT-ORB3009190-1, BYT-ORB3009190-100, BYT-ORB3009190-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: MKRN2 opposite strand protein, MKRN2 antisense RNA 1, MKRN2 antisense gene protein 1, MKRN2OS C3orf83 MKRN2-AS1

Produktbeschreibung

This Recombinant Human MKRN2 opposite strand protein (MKROS) spans the amino acid sequence from region 1-223. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: H3BPM6
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MHCAEAGKALIKFNHCEKYIYSFSVPQCCPLCQQDLGSRKLEDAPVSIANPFTNGHQEKCSFLLRPTQGTFLREYDGRSDLHVGITNTNGVVYNYSAHGVQRDGEGWEESISIPLLQPNMYGMMEQWDKYLEDFSTSGAWLPHRYEDNHHNCYSYALTFINCVLMAEGRQQLDKGEFTEKYVVPRTRLASKFITLYRAIREHGFYVTDCPQQQAQPPEGGGLC

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)