Recombinant Human MKRN2 opposite strand protein (MKROS)

Product Overview

• Article Name: Recombinant Human MKRN2 opposite strand protein (MKROS)
• Biozol Catalog Number: BYT-ORB3009190
• Supplier Catalog Number: orb3009190
• Alternative Catalog Number: BYT-ORB3009190-1, BYT-ORB3009190-100, BYT-ORB3009190-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: MKRN2 opposite strand protein, MKRN2 antisense RNA 1, MKRN2 antisense gene protein 1, MKRN2OS C3orf83 MKRN2-AS1

Product Description

This Recombinant Human MKRN2 opposite strand protein (MKROS) spans the amino acid sequence from region 1-223. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: H3BPM6
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MHCAEAGKALIKFNHCEKYIYSFSVPQCCPLCQQDLGSRKLEDAPVSIANPFTNGHQEKCSFLLRPTQGTFLREYDGRSDLHVGITNTNGVVYNYSAHGVQRDGEGWEESISIPLLQPNMYGMMEQWDKYLEDFSTSGAWLPHRYEDNHHNCYSYALTFINCVLMAEGRQQLDKGEFTEKYVVPRTRLASKFITLYRAIREHGFYVTDCPQQQAQPPEGGGLC

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)