Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3)

Produktübersicht

• Artikelname: Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3)
• Artikelnummer: BYT-ORB3009196
• Hersteller Artikelnummer: orb3009196
• Alternativnummer: BYT-ORB3009196-1, BYT-ORB3009196-100, BYT-ORB3009196-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3, Rhodanese domain-containing protein 3, TSTD3

Produktbeschreibung

This Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3) spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: H0UI37
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQKIPESINVPLDEVGEALQMNPRDFKEKYNEVKPSKSDS

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)