Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3)

Catalog Number: BYT-ORB3009196
Article Name: Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3)
Biozol Catalog Number: BYT-ORB3009196
Supplier Catalog Number: orb3009196
Alternative Catalog Number: BYT-ORB3009196-1, BYT-ORB3009196-100, BYT-ORB3009196-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3, Rhodanese domain-containing protein 3, TSTD3
This Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3) spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: H0UI37
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQKIPESINVPLDEVGEALQMNPRDFKEKYNEVKPSKSDS
Application Notes: Biological Origin: Homo sapiens (Human)