Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079)

Artikelnummer: BYT-ORB3009197
Artikelname: Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079)
Artikelnummer: BYT-ORB3009197
Hersteller Artikelnummer: orb3009197
Alternativnummer: BYT-ORB3009197-1, BYT-ORB3009197-100, BYT-ORB3009197-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Uncharacterized protein encoded by LINC01619 LINC01619 C12orf79
This Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079) spans the amino acid sequence from region 1-115. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: G3V211
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MNVCCSSHPVNEKVWKPSSRKWSSKVWSMDEFDLQTACYWFMTRCQKEAGKFGTHRGKPMCFVRSLLRVQLLPRTFPANSFVISFFPSLIYPLQVYQLHFESSDKQRAMQFVTEG
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)