Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079)

Catalog Number: BYT-ORB3009197
Article Name: Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079)
Biozol Catalog Number: BYT-ORB3009197
Supplier Catalog Number: orb3009197
Alternative Catalog Number: BYT-ORB3009197-1, BYT-ORB3009197-100, BYT-ORB3009197-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Uncharacterized protein encoded by LINC01619 LINC01619 C12orf79
This Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079) spans the amino acid sequence from region 1-115. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: G3V211
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MNVCCSSHPVNEKVWKPSSRKWSSKVWSMDEFDLQTACYWFMTRCQKEAGKFGTHRGKPMCFVRSLLRVQLLPRTFPANSFVISFFPSLIYPLQVYQLHFESSDKQRAMQFVTEG
Application Notes: Biological Origin: Homo sapiens (Human)