Recombinant Human Nuclear pore complex-interacting protein family member B6 (NPIB6)

Artikelnummer: BYT-ORB3009208
Artikelname: Recombinant Human Nuclear pore complex-interacting protein family member B6 (NPIB6)
Artikelnummer: BYT-ORB3009208
Hersteller Artikelnummer: orb3009208
Alternativnummer: BYT-ORB3009208-1, BYT-ORB3009208-100, BYT-ORB3009208-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Nuclear pore complex-interacting protein family member B6 NPIPB6
This Recombinant Human Nuclear pore complex-interacting protein family member B6 (NPIB6) spans the amino acid sequence from region 1-425. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: E9PJ23
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVKLSIVLTPQFLSHDQSQLTKELQQHVKSVTCPCEYLRKVINSLAVYRHRETDFGVGVRDHPGQHGKTPSPQKLDNLIIIIIGFLRRYTFNILFCTSCLCVSFLKTIFWSRNGHDGSMDVQQRAWRSNRSRQKGLRSICMHTKKRVSSFRGNKIGLKDVITLRRHVETKVRAKIRKRKVTTKINRHDKINGKRKTARKQKMFQRAQELRRRAEDYHKCKIPPSARKPLCNWVRMVAAEHRHSSGLPYWPYLTAE
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)