Recombinant Human Nuclear pore complex-interacting protein family member B6 (NPIB6)

Catalog Number: BYT-ORB3009208
Article Name: Recombinant Human Nuclear pore complex-interacting protein family member B6 (NPIB6)
Biozol Catalog Number: BYT-ORB3009208
Supplier Catalog Number: orb3009208
Alternative Catalog Number: BYT-ORB3009208-1, BYT-ORB3009208-100, BYT-ORB3009208-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Nuclear pore complex-interacting protein family member B6 NPIPB6
This Recombinant Human Nuclear pore complex-interacting protein family member B6 (NPIB6) spans the amino acid sequence from region 1-425. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: E9PJ23
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MVKLSIVLTPQFLSHDQSQLTKELQQHVKSVTCPCEYLRKVINSLAVYRHRETDFGVGVRDHPGQHGKTPSPQKLDNLIIIIIGFLRRYTFNILFCTSCLCVSFLKTIFWSRNGHDGSMDVQQRAWRSNRSRQKGLRSICMHTKKRVSSFRGNKIGLKDVITLRRHVETKVRAKIRKRKVTTKINRHDKINGKRKTARKQKMFQRAQELRRRAEDYHKCKIPPSARKPLCNWVRMVAAEHRHSSGLPYWPYLTAE
Application Notes: Biological Origin: Homo sapiens (Human)