Recombinant Human Uroplakin-3b-like protein 2 (UPKL2), partial

Artikelnummer: BYT-ORB3009212
Artikelname: Recombinant Human Uroplakin-3b-like protein 2 (UPKL2), partial
Artikelnummer: BYT-ORB3009212
Hersteller Artikelnummer: orb3009212
Alternativnummer: BYT-ORB3009212-1, BYT-ORB3009212-100, BYT-ORB3009212-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Uroplakin-3b-like protein 2 UPK3BL2
This Recombinant Human Uroplakin-3b-like protein 2 (UPKL2), partial spans the amino acid sequence from region 34-204. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: E5RIL1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GTDVAAPEHISYVPQLSNDTLAGRLTLSTFTLEQPLGQFSSHNISDLDTIWLVVALSNATQSFTAPRTNQDIPAPANFSQRGYYLTLRANRVLYQTRGQLHVLRVGNDTHCQPTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVPGPQSPGTVV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)