Recombinant Human Uroplakin-3b-like protein 2 (UPKL2), partial

Catalog Number: BYT-ORB3009212
Article Name: Recombinant Human Uroplakin-3b-like protein 2 (UPKL2), partial
Biozol Catalog Number: BYT-ORB3009212
Supplier Catalog Number: orb3009212
Alternative Catalog Number: BYT-ORB3009212-1, BYT-ORB3009212-100, BYT-ORB3009212-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Uroplakin-3b-like protein 2 UPK3BL2
This Recombinant Human Uroplakin-3b-like protein 2 (UPKL2), partial spans the amino acid sequence from region 34-204. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: E5RIL1
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GTDVAAPEHISYVPQLSNDTLAGRLTLSTFTLEQPLGQFSSHNISDLDTIWLVVALSNATQSFTAPRTNQDIPAPANFSQRGYYLTLRANRVLYQTRGQLHVLRVGNDTHCQPTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVPGPQSPGTVV
Application Notes: Biological Origin: Homo sapiens (Human)