Recombinant Human Putative serine protease 46 (PRS46)

Produktübersicht

• Artikelname: Recombinant Human Putative serine protease 46 (PRS46)
• Artikelnummer: BYT-ORB3009214
• Hersteller Artikelnummer: orb3009214
• Alternativnummer: BYT-ORB3009214-1, BYT-ORB3009214-100, BYT-ORB3009214-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Putative serine protease 46, EC 3.4.21.-, Serine protease 46 pseudogene, PRSS46P PRSS46

Produktbeschreibung

This Recombinant Human Putative serine protease 46 (PRS46) spans the amino acid sequence from region 1-174. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: E5RG02
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MACGPGDLQSLTSPLSSARLDYQPSIEGPWLRACGQTNVSCRVVKGKLVEVGKWPWQVSILFLGTYICSGSLIHHQWVLTAAHCLQRFKDLSLYSVMVGVHQRPENSTQLPLTRMVIHKDFSNLMSQDIALLKLRDSISWSPFVQPVCLPNIKFKPSIGSMCWVIGWGTTGKKG

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)