Recombinant Human Putative serine protease 46 (PRS46)

Product Overview

• Article Name: Recombinant Human Putative serine protease 46 (PRS46)
• Biozol Catalog Number: BYT-ORB3009214
• Supplier Catalog Number: orb3009214
• Alternative Catalog Number: BYT-ORB3009214-1, BYT-ORB3009214-100, BYT-ORB3009214-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Putative serine protease 46, EC 3.4.21.-, Serine protease 46 pseudogene, PRSS46P PRSS46

Product Description

This Recombinant Human Putative serine protease 46 (PRS46) spans the amino acid sequence from region 1-174. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: E5RG02
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MACGPGDLQSLTSPLSSARLDYQPSIEGPWLRACGQTNVSCRVVKGKLVEVGKWPWQVSILFLGTYICSGSLIHHQWVLTAAHCLQRFKDLSLYSVMVGVHQRPENSTQLPLTRMVIHKDFSNLMSQDIALLKLRDSISWSPFVQPVCLPNIKFKPSIGSMCWVIGWGTTGKKG

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)