Recombinant Human Cilia- and flagella-associated protein 99 (CFA99)

Produktübersicht

• Artikelname: Recombinant Human Cilia- and flagella-associated protein 99 (CFA99)
• Artikelnummer: BYT-ORB3009217
• Hersteller Artikelnummer: orb3009217
• Alternativnummer: BYT-ORB3009217-1, BYT-ORB3009217-100, BYT-ORB3009217-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cilia- and flagella-associated protein 99 CFAP99

Produktbeschreibung

This Recombinant Human Cilia- and flagella-associated protein 99 (CFA99) spans the amino acid sequence from region 1-646. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: D6REC4
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAYYGKCIETVIEQLDKFTPKRDNPEQFLEAAATSLQALSPQKQSFVLEVLSGCLEYRKLLTVVVDAFYVEDGRLCLRVDHSRFEVICYLATFLLEELGFQLFCNIIKSQPVDKMCKFLRFFFNPLHLCSWIKDEWSLIYEPAHVKENWIDPLMRWQPEVQELINHLEGVSASQSSPLKTKAKVTEPKEFNLTAPRPRTIPAPEPVPVVAKPRPVPQSTYQPPKEQQQLETVKRYNRRKAEELLLRANIEELRCA

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)