Recombinant Human Cilia- and flagella-associated protein 99 (CFA99)

Product Overview

• Article Name: Recombinant Human Cilia- and flagella-associated protein 99 (CFA99)
• Biozol Catalog Number: BYT-ORB3009217
• Supplier Catalog Number: orb3009217
• Alternative Catalog Number: BYT-ORB3009217-1, BYT-ORB3009217-100, BYT-ORB3009217-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: Cilia- and flagella-associated protein 99 CFAP99

Product Description

This Recombinant Human Cilia- and flagella-associated protein 99 (CFA99) spans the amino acid sequence from region 1-646. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: D6REC4
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MAYYGKCIETVIEQLDKFTPKRDNPEQFLEAAATSLQALSPQKQSFVLEVLSGCLEYRKLLTVVVDAFYVEDGRLCLRVDHSRFEVICYLATFLLEELGFQLFCNIIKSQPVDKMCKFLRFFFNPLHLCSWIKDEWSLIYEPAHVKENWIDPLMRWQPEVQELINHLEGVSASQSSPLKTKAKVTEPKEFNLTAPRPRTIPAPEPVPVVAKPRPVPQSTYQPPKEQQQLETVKRYNRRKAEELLLRANIEELRCA

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)