Recombinant Human Ubiquitin carboxyl-terminal hydrolase 17-like protein 23 (U17LN), partial

Produktübersicht

• Artikelname: Recombinant Human Ubiquitin carboxyl-terminal hydrolase 17-like protein 23 (U17LN), partial
• Artikelnummer: BYT-ORB3009218
• Hersteller Artikelnummer: orb3009218
• Alternativnummer: BYT-ORB3009218-1, BYT-ORB3009218-100, BYT-ORB3009218-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Ubiquitin carboxyl-terminal hydrolase 17-like protein 23 USP17L23

Produktbeschreibung

This Recombinant Human Ubiquitin carboxyl-terminal hydrolase 17-like protein 23 (U17LN), partial spans the amino acid sequence from region 1-183. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: D6RBM5
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSCETRVDLCDDLAPVARQLAPREKLPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREHSQTCHRHKGCMLCTMQAHITRALHNPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMEKACLPGHKQV

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)