Recombinant Human Ubiquitin carboxyl-terminal hydrolase 17-like protein 23 (U17LN), partial

Catalog Number: BYT-ORB3009218
Article Name: Recombinant Human Ubiquitin carboxyl-terminal hydrolase 17-like protein 23 (U17LN), partial
Biozol Catalog Number: BYT-ORB3009218
Supplier Catalog Number: orb3009218
Alternative Catalog Number: BYT-ORB3009218-1, BYT-ORB3009218-100, BYT-ORB3009218-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Ubiquitin carboxyl-terminal hydrolase 17-like protein 23 USP17L23
This Recombinant Human Ubiquitin carboxyl-terminal hydrolase 17-like protein 23 (U17LN), partial spans the amino acid sequence from region 1-183. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: D6RBM5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEDDSLYLGGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSCETRVDLCDDLAPVARQLAPREKLPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREHSQTCHRHKGCMLCTMQAHITRALHNPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMEKACLPGHKQV
Application Notes: Biological Origin: Homo sapiens (Human)