Recombinant Human Protein PRAC2 (PRAC2)

Produktübersicht

• Artikelname: Recombinant Human Protein PRAC2 (PRAC2)
• Artikelnummer: BYT-ORB3009219
• Hersteller Artikelnummer: orb3009219
• Alternativnummer: BYT-ORB3009219-1, BYT-ORB3009219-100, BYT-ORB3009219-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Protein PRAC2, Prostate, rectum and colon expressed gene protein 2, PRAC2 C17orf93 HOXB-AS5 HOXB13-AS1 NCRNA00253

Produktbeschreibung

This Recombinant Human Protein PRAC2 (PRAC2) spans the amino acid sequence from region 1-90. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: D3DTV9
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MDRRRMALRPGSRRPTAFFFHSRWLVPNLLAFFLGLSGAGPIHLPMPWPNGRRHRVLDPHTQLSTHEAPGRWKPVAPRTMKACPQVLLEW

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)