Recombinant Human Protein PRAC2 (PRAC2)

Catalog Number: BYT-ORB3009219
Article Name: Recombinant Human Protein PRAC2 (PRAC2)
Biozol Catalog Number: BYT-ORB3009219
Supplier Catalog Number: orb3009219
Alternative Catalog Number: BYT-ORB3009219-1, BYT-ORB3009219-100, BYT-ORB3009219-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein PRAC2, Prostate, rectum and colon expressed gene protein 2, PRAC2 C17orf93 HOXB-AS5 HOXB13-AS1 NCRNA00253
This Recombinant Human Protein PRAC2 (PRAC2) spans the amino acid sequence from region 1-90. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: D3DTV9
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDRRRMALRPGSRRPTAFFFHSRWLVPNLLAFFLGLSGAGPIHLPMPWPNGRRHRVLDPHTQLSTHEAPGRWKPVAPRTMKACPQVLLEW
Application Notes: Biological Origin: Homo sapiens (Human)