Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial

Produktübersicht

• Artikelname: Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial
• Artikelnummer: BYT-ORB3009220
• Hersteller Artikelnummer: orb3009220
• Alternativnummer: BYT-ORB3009220-1, BYT-ORB3009220-100, BYT-ORB3009220-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Nuclear pore complex-interacting protein family member B4 NPIPB4

Produktbeschreibung

This Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial spans the amino acid sequence from region 1-62. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: C9JG80
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLH

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)