Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial

Catalog Number: BYT-ORB3009220
Article Name: Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial
Biozol Catalog Number: BYT-ORB3009220
Supplier Catalog Number: orb3009220
Alternative Catalog Number: BYT-ORB3009220-1, BYT-ORB3009220-100, BYT-ORB3009220-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Nuclear pore complex-interacting protein family member B4 NPIPB4
This Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial spans the amino acid sequence from region 1-62. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: C9JG80
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLH
Application Notes: Biological Origin: Homo sapiens (Human)