Recombinant Human UBAP1-MVB12-associated (UMAD1)

Artikelnummer: BYT-ORB3009221
Artikelname: Recombinant Human UBAP1-MVB12-associated (UMAD1)
Artikelnummer: BYT-ORB3009221
Hersteller Artikelnummer: orb3009221
Alternativnummer: BYT-ORB3009221-1, BYT-ORB3009221-100, BYT-ORB3009221-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: UBAP1-MVB12-associated, UMA-domain containing protein 1, RPA3 antisense RNA 1, RPA3 opposite strand, UMAD1 RPA3-AS1 RPA3OS
This Recombinant Human UBAP1-MVB12-associated (UMAD1) spans the amino acid sequence from region 1-137. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: C9J7I0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MFHFFRKPPESKKPSVPETEADGFVLLGDTTDEQRMTARGKTSDIEANQPLETNKENSSSVTVSDPEMENKAGQTLENSSLMAELLSDVPFTLAPHVLAVQGTITDLPDHLLSYDGSENLSRFWYDFTLENSVLCDS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)