Recombinant Human UBAP1-MVB12-associated (UMAD1)

Product Overview

• Article Name: Recombinant Human UBAP1-MVB12-associated (UMAD1)
• Biozol Catalog Number: BYT-ORB3009221
• Supplier Catalog Number: orb3009221
• Alternative Catalog Number: BYT-ORB3009221-1, BYT-ORB3009221-100, BYT-ORB3009221-20
• Manufacturer: Biorbyt
• Category: Proteine/Peptide
• Alternative Names: UBAP1-MVB12-associated, UMA-domain containing protein 1, RPA3 antisense RNA 1, RPA3 opposite strand, UMAD1 RPA3-AS1 RPA3OS

Product Description

This Recombinant Human UBAP1-MVB12-associated (UMAD1) spans the amino acid sequence from region 1-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Properties

• UniProt: C9J7I0
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Source: Homo sapiens (Human)
• Purity: Greater than 85% as determined by SDS-PAGE.
• Form: Liquid or Lyophilized powder
• Sequence: MFHFFRKPPESKKPSVPETEADGFVLLGDTTDEQRMTARGKTSDIEANQPLETNKENSSSVTVSDPEMENKAGQTLENSSLMAELLSDVPFTLAPHVLAVQGTITDLPDHLLSYDGSENLSRFWYDFTLENSVLCDS

Application Notes

• Application Notes: Biological Origin: Homo sapiens (Human)