Recombinant Human T-complex protein 11-like X-linked protein 1 (T11X1)

Artikelnummer: BYT-ORB3009227
Artikelname: Recombinant Human T-complex protein 11-like X-linked protein 1 (T11X1)
Artikelnummer: BYT-ORB3009227
Hersteller Artikelnummer: orb3009227
Alternativnummer: BYT-ORB3009227-1, BYT-ORB3009227-100, BYT-ORB3009227-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: T-complex protein 11-like X-linked protein 1 TCP11X1
This Recombinant Human T-complex protein 11-like X-linked protein 1 (T11X1) spans the amino acid sequence from region 1-502. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: B4DZS4
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MPKTEETVLQNDPSVAENGAPEPKTPGQSQKSKSFCLDDQSPDLIETVNEVSKLSISHEIVVNQDFYVEETILPPNSVEGRFAEAMYNAFWNHLKEQLLSTPPDFTCALELLKDVKETLLSLLLPWQNRLRNEIEEALDTDLLKQEAEHGALDVPHLSNYILNLMALLCAPVRDEAIQKLETIRDPVQLLRGILRVLGLMKMDMVNYTIQSFRPYLQEHSIQYEQAKFQELLDKQPSLLDYTTKWLTKAATDITT
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)