Recombinant Human T-complex protein 11-like X-linked protein 1 (T11X1)

Catalog Number: BYT-ORB3009227
Article Name: Recombinant Human T-complex protein 11-like X-linked protein 1 (T11X1)
Biozol Catalog Number: BYT-ORB3009227
Supplier Catalog Number: orb3009227
Alternative Catalog Number: BYT-ORB3009227-1, BYT-ORB3009227-100, BYT-ORB3009227-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: T-complex protein 11-like X-linked protein 1 TCP11X1
This Recombinant Human T-complex protein 11-like X-linked protein 1 (T11X1) spans the amino acid sequence from region 1-502. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: B4DZS4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPKTEETVLQNDPSVAENGAPEPKTPGQSQKSKSFCLDDQSPDLIETVNEVSKLSISHEIVVNQDFYVEETILPPNSVEGRFAEAMYNAFWNHLKEQLLSTPPDFTCALELLKDVKETLLSLLLPWQNRLRNEIEEALDTDLLKQEAEHGALDVPHLSNYILNLMALLCAPVRDEAIQKLETIRDPVQLLRGILRVLGLMKMDMVNYTIQSFRPYLQEHSIQYEQAKFQELLDKQPSLLDYTTKWLTKAATDITT
Application Notes: Biological Origin: Homo sapiens (Human)