Recombinant Human Protein CEBPZOS (CEBOS), partial

Produktübersicht

• Artikelname: Recombinant Human Protein CEBPZOS (CEBOS), partial
• Artikelnummer: BYT-ORB3009229
• Hersteller Artikelnummer: orb3009229
• Alternativnummer: BYT-ORB3009229-1, BYT-ORB3009229-100, BYT-ORB3009229-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Protein CEBPZOS, CEBPZ antisense RNA 1, CEBPZ opposite strand, CEBPZOS CEBPZ-AS1

Produktbeschreibung

This Recombinant Human Protein CEBPZOS (CEBOS), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• UniProt: A8MTT3
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: KMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIRELDQKTWLNSKN

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human)