Recombinant Human Protein CEBPZOS (CEBOS), partial

Catalog Number: BYT-ORB3009229
Article Name: Recombinant Human Protein CEBPZOS (CEBOS), partial
Biozol Catalog Number: BYT-ORB3009229
Supplier Catalog Number: orb3009229
Alternative Catalog Number: BYT-ORB3009229-1, BYT-ORB3009229-100, BYT-ORB3009229-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Protein CEBPZOS, CEBPZ antisense RNA 1, CEBPZ opposite strand, CEBPZOS CEBPZ-AS1
This Recombinant Human Protein CEBPZOS (CEBOS), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.
UniProt: A8MTT3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIRELDQKTWLNSKN
Application Notes: Biological Origin: Homo sapiens (Human)