LOC100360880 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324389
| Artikelname: |
LOC100360880 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324389 |
| Hersteller Artikelnummer: |
orb324389 |
| Alternativnummer: |
BYT-ORB324389-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Rat |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat LOC100360880 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti Fosb antibody, anti fra-2 antibody, anti LOC100360880 antibody |
| Rabbit polyclonal antibody to Fosb |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
35kDa |
| NCBI: |
002725585 |
| UniProt: |
D3ZLB7 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: AFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGS |
| Target-Kategorie: |
Fosb |
