LOC100360880 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324389
| Article Name: |
LOC100360880 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324389 |
| Supplier Catalog Number: |
orb324389 |
| Alternative Catalog Number: |
BYT-ORB324389-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Rat |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat LOC100360880 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti Fosb antibody, anti fra-2 antibody, anti LOC100360880 antibody |
| Rabbit polyclonal antibody to Fosb |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
35kDa |
| NCBI: |
002725585 |
| UniProt: |
D3ZLB7 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: AFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGS |
| Target: |
Fosb |
