C13ORF8 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: C13ORF8 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324392
• Hersteller Artikelnummer: orb324392
• Alternativnummer: BYT-ORB324392-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C13ORF8
• Konjugation: Unconjugated
• Alternative Synonym: anti ARCD antibody, anti ARP9 antibody, anti ARP-9 antibody, anti CEM15 antibody, anti CEM-15 antibody, anti MDS019 antibody, anti bK150C2.7 antibody, anti dJ494G10.1 antibody, anti C13ORF8 antibody

Produktbeschreibung

Rabbit polyclonal antibody to APOBEC3G

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 89kDa
• NCBI: 115812
• UniProt: Q96JM3
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: PAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEPRRPAPAVSPG
• Target-Kategorie: APOBEC3G