C13ORF8 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: C13ORF8 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324392
• Supplier Catalog Number: orb324392
• Alternative Catalog Number: BYT-ORB324392-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C13ORF8
• Conjugation: Unconjugated
• Alternative Names: anti ARCD antibody, anti ARP9 antibody, anti ARP-9 antibody, anti CEM15 antibody, anti CEM-15 antibody, anti MDS019 antibody, anti bK150C2.7 antibody, anti dJ494G10.1 antibody, anti C13ORF8 antibody

Product Description

Rabbit polyclonal antibody to APOBEC3G

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 89kDa
• NCBI: 115812
• UniProt: Q96JM3
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEPRRPAPAVSPG
• Target: APOBEC3G