HTATIP Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: HTATIP Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324420
• Hersteller Artikelnummer: orb324420
• Alternativnummer: BYT-ORB324420-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTATIP
• Konjugation: Unconjugated
• Alternative Synonym: anti ESA1 antibody, anti HTATIP1 antibody, anti KAT5 antibody, anti PLIP antibody, anti TIP antibody, anti TIP60 antibody, anti cPLA2 antibody, anti HTATIP antibody

Produktbeschreibung

Rabbit polyclonal antibody to KAT5

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 62kDa
• NCBI: 874369
• UniProt: C9JL99
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: EAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKERE
• Target-Kategorie: KAT5