HTATIP Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: HTATIP Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324420
• Supplier Catalog Number: orb324420
• Alternative Catalog Number: BYT-ORB324420-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTATIP
• Conjugation: Unconjugated
• Alternative Names: anti ESA1 antibody, anti HTATIP1 antibody, anti KAT5 antibody, anti PLIP antibody, anti TIP antibody, anti TIP60 antibody, anti cPLA2 antibody, anti HTATIP antibody

Product Description

Rabbit polyclonal antibody to KAT5

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 62kDa
• NCBI: 874369
• UniProt: C9JL99
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: EAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKERE
• Target: KAT5